- Venta y Alquiler de DVD y Video - 14.000 Títulos is the 2138377:th largest website within the world. The website is created in 02/04/2001, owned by n/a, currently located in Argentina and is running on IP registered by Tucows Domains Inc. network. This site not uses Javascript for user interaction. This site not uses CSS to manage the site layout. This site is running on the Microsoft-IIS/8.5 webserver. The server side programming lanquage of the site is n/a. Google Pagerank is n/a and it's domain is Commercial. estimated worth is $1,869.83, with 468 estimated visites per day and ad revenue of $1.40.

General Info Analysis

World Rank: #2138377
Created: 02/04/2001
Expires: n/a
Google PR: n/a
Load Time: 2.07 seconds
Owner: n/a
Hosted: Argentina
Host IP:
Registrar Tucows Domains Inc.
Family Safety:
Charset: n/a

Meta Tags Analysis

Title: Venta y Alquiler de DVD y Video - 14.000 Títulos
Description: n/a
Author: n/a

Website Value Analysis

We are absolutely certain that every one is able to earn money from his website, Therefor we will display a short estimated numbers that might be achievable through dedication and seriousness work on your website.
Our estimations point that your Website Value is $1,869.83, Your Daily Visitors could be in the area of 468 per day and your potential Daily Revenues could be around $1.40.

Website Theme Colors

Website theme colors for current domain a N/A but you definitely can check some colors from FoxColors webmaster service.

Provided by FoxColors - Color hex code related information and conversions

Technical Info Analysis

Server DNS A:
Server DNS NS:
Server Name:
Server Type: Microsoft-IIS/8.5
Server Side Language: n/a
Javascript Usage: no
CSS Usage: no
RSS Usage: no
Google AdSense Usage: no
Code to Text: 22.385 %
Additional Technologies: n/a

Domain Name Analysis

Length: 19 characters
Created: 02/04/2001
Expires: n/a
Owner: n/a
Registrar: Tucows Domains Inc.
Extension: com

Keywords Density Analysis

Keyword Count Density (%)
Iacute 5 4.46
Alquiler 2 1.79
Virgin 2 1.79
Dvd 2 1.79
Cityvenezuelavietnamwallis 1 0.89
Guineaparaguayperuphillippinespitcairnpolandportugalpuerto 1 0.89
Principesaudi 1 0.89
Tome 1 0.89
Marinosao 1 0.89
Grenadinessamoasan 1 0.89
Vincent 1 0.89
Luciasaint 1 0.89
Ricoqatarreunionromaniarussiarwandasaint 1 0.89
Koreanorwayomanpakistanpanamapapua 1 0.89
Leonesingaporesolomon 1 0.89
Islandnorth 1 0.89
Zealandnicaraguanigernigerianiuenorfolk 1 0.89
Caledonianew 1 0.89
Coastjamaicajapanjordankazakstankenyakirguistankiribatikuwaitlaoslebanonlesotholetonialiberialibyaliechtensteinlituanialuxembourgmacaomacedoniamadagascarmalawimalaysiamaldivesmalimaltamartiniquemauritaniamauritiusmexicomicronesiamoldovamonacomontserratmoroccomozambiquenamibianaurunepalnetherlandsnew 1 0.89
Palaosisraelitalyivory 1 0.89
Marshalislas 1 0.89

HTTP Header Analysis

Cache-Control: private
Content-Type: text/html
Server: Microsoft-IIS/8.5
Date: Sat, 16 Dec 2017 11:58:05 GMT
Content-Length: 13098

Website Speed Analysis

Header Size: 222 KB
Request Size: 148 KB
Name Lookup Time: 1.51 seconds
Connect Time: 1.69 seconds
Pretransfer Time: 1.69 seconds
Total Time: 2.07 seconds
Size Download: 13098 KB
Speed Download: 6327 KB/S

Geo Location Analysis

Server Country Code: AR
Server Country Name: Argentina
Server City Name: San Telmo
Server Region Name: 07
Server Zip Code: 1871
Server Latitude: -34.61669921875
Server Longitude: -58.36669921875

Network IP Calcualtor

Address 10111110.11010010.01100010.01001010
Netmask = 24 11111111.11111111.11111111.00000000
Wildcard 00000000.00000000.00000000.11111111
Network 10111110.11010010.01100010.00000000
HostMin 10111110.11010010.01100010.00000001
HostMax 10111110.11010010.01100010.11111110
Broadcast 10111110.11010010.01100010.11111111
Hosts/Net 254 Class B

Alternative Domain Spelling

vndeomaniaticos, vqdeomaniaticos, vsdeomaniaticos, vigeomaniaticos, vireomaniaticos, viseomaniaticos, viteomaniaticos, vidjomaniaticos, vidqomaniaticos, videozaniaticos, videomyniaticos, videomayiaticos, videomaziaticos, videomangaticos, videomanraticos, videomaninticos, videomaniuticos, videomaniacicos, videomaniauicos, videomaniatdcos, videomaniatrcos, videomaniaticzs, videomaniaticok, videomaniaticos, videomaniaticoz, evideomaniaticos, uvideomaniaticos, vvideomaniaticos, vlideomaniaticos, viedeomaniaticos, viwdeomaniaticos, vidveomaniaticos, videoomaniaticos, videoimaniaticos, videomqaniaticos, videomwaniaticos, videomahniaticos, videomanniaticos, videomanibaticos, videomaniazticos, videomaniatvicos, videomaniatircos, videomaniatiwcos, videomaniaticdos, videomaniaticofs, videomaniaticous, videomaniaticovs, videomaniaticoxs, videomaniaticosl, videomaniaticosy,

Website Whois Analysis

Registry Domain ID: 68704312_DOMAIN_COM-VRSN
Registrar WHOIS Server:
Registrar URL:
Updated Date: 2017-04-03T15:05:12Z
Creation Date: 2001-04-02T18:38:04Z
Registry Expiry Date: 2018-04-02T18:38:04Z
Registrar: Tucows Domains Inc.
Registrar IANA ID: 69
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: ok
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form:
>>> Last update of whois database: 2017-12-16T11:57:43Z <<<

For more information on Whois status codes, please visit

NOTICE: The expiration date displayed in this record is the date the
registrar's sponsorship of the domain name registration in the registry is
currently set to expire. This date does not necessarily reflect the expiration
date of the domain name registrant's agreement with the sponsoring
registrar. Users may consult the sponsoring registrar's Whois database to
view the registrar's reported date of expiration for this registration.

TERMS OF USE: You are not authorized to access or query our Whois
database through the use of electronic processes that are high-volume and
automated except as reasonably necessary to register domain names or
modify existing registrations; the Data in VeriSign Global Registry
Services' ("VeriSign") Whois database is provided by VeriSign for
information purposes only, and to assist persons in obtaining information
about or related to a domain name registration record. VeriSign does not
guarantee its accuracy. By submitting a Whois query, you agree to abide
by the following terms of use: You agree that you may use this Data only
for lawful purposes and that under no circumstances will you use this Data
to: (1) allow, enable, or otherwise support the transmission of mass
unsolicited, commercial advertising or solicitations via e-mail, telephone,
or facsimile; or (2) enable high volume, automated, electronic processes
that apply to VeriSign (or its computer systems). The compilation,
repackaging, dissemination or other use of this Data is expressly
prohibited without the prior written consent of VeriSign. You agree not to
use electronic processes that are automated and high-volume to access or
query the Whois database except as reasonably necessary to register
domain names or modify existing registrations. VeriSign reserves the right
to restrict your access to the Whois database in its sole discretion to ensure
operational stability. VeriSign may restrict or terminate your access to the
Whois database for failure to abide by these terms of use. VeriSign
reserves the right to modify these terms at any time.

The Registry database contains ONLY .COM, .NET, .EDU domains and

Website Report Menu

Recent Websites

Visited Websites

Similar Alexa

FoxMos Widget


Copy & Paste code at your site or blog!

FoxMaster Latest Posts